Protein Sequence of the antigen tr|Q9Q8Q5|Q9Q8Q5_MYXVL M41L OS=Myxoma virus (strain Lausanne) OX=31530 GN=m041L PE=4 SV=1

MALTVKEVISFIGTTLLFVFMVLAGSALVFKTYAPHKVVVARSAAFMRVVNFFEFVAILVFIPGTLSLYWSYVKSLRF

Download Epitopes

Epitope Number Epitope Epitope Prediction Score Epitope Start Epitope End
1 MALTVKEVIS 1.0 1 10
2 FIGTTLLFVFM 1.0 11 21
3 KTYAPHKVVVAR 1.0 31 42
4 SAAFMRVVNF 0.9989628 43 52
5 FEFVAILVFIP 1.0 53 63