Protein Sequence of the antigen tr|Q9Q8M3|Q9Q8M3_MYXVL M77L OS=Myxoma virus (strain Lausanne) OX=31530 GN=m077L PE=4 SV=2

MEFDIKKLTDLLQNNRIVCPNDIKKIYNERFIVLEKGRYKIRNIHVYSSAARFDNKTMFGVVKYLYKHNEAIIDMLFPSKTVYESIREIAPDYTVAISTDDSEPSNPVTVLLNIFNSFRFGKRDAPVPYYYLPLGEDVYDVVA

Download Epitopes

Epitope Number Epitope Epitope Prediction Score Epitope Start Epitope End
1 MEFDIKKLTD 0.88629925 1 10
2 RNIHVYSSAARFDN 0.99963725 42 55
3 KTMFGVVKYLYK 1.0 56 67
4 HNEAIIDMLFPS 1.0 68 79
5 KTVYESIRE 1.0 80 88
6 IAPDYTVAISTDD 0.9293746 89 101
7 SEPSNPVTVL 1.0 102 111
8 APVPYYYLPLG 1.0 125 135