Protein Sequence of the antigen tr|Q9J5E4|Q9J5E4_FOWPN ORF FPV067 HT motif gene family protein OS=Fowlpox virus (strain NVSL) OX=928301 GN=FPV067 PE=4 SV=1

MFISPIMVKIVFVMNSRKDIDVILCRFHEMTNYAFKSVYQRFCYRLQCSRMGKYHKTVTFRNTIEPKIKELIKRIRGFTVYKITIQPEET

Download Epitopes

Epitope Number Epitope Epitope Prediction Score Epitope Start Epitope End
1 TNYAFKSVYQRFC 0.99998456 31 43
2 YRLQCSRMGKYHK 0.7871473 44 56
3 TVTFRNTIEP 0.9999852 57 66
4 KIKELIKRI 1.0 67 75