Protein Sequence of the antigen tr|Q9J5E4|Q9J5E4_FOWPN ORF FPV067 HT motif gene family protein OS=Fowlpox virus (strain NVSL) OX=928301 GN=FPV067 PE=4 SV=1
MFISPIMVKIVFVMNSRKDIDVILCRFHEMTNYAFKSVYQRFCYRLQCSRMGKYHKTVTFRNTIEPKIKELIKRIRGFTVYKITIQPEET
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | TNYAFKSVYQRFC | 0.99998456 | 31 | 43 |
| 2 | YRLQCSRMGKYHK | 0.7871473 | 44 | 56 |
| 3 | TVTFRNTIEP | 0.9999852 | 57 | 66 |
| 4 | KIKELIKRI | 1.0 | 67 | 75 |