Protein Sequence of the antigen tr|Q9J585|Q9J585_FOWPN ORF FPV145 Molluscum contagiosum virus MC089L homolog OS=Fowlpox virus (strain NVSL) OX=928301 GN=FPV145 PE=4 SV=1
MIVILVIYIIVIVFFLFMLTKKATSVRLDKDNMILSGLYKDKITAQNTLVKLQEELSEKKTNYSAWYDLTSSNELNKHKDIKRMDPYTAMKFTYDLLDRWRLL
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MIVILVIYIIVIV | 1.0 | 1 | 13 |
| 2 | FFLFMLTKKA | 1.0 | 14 | 23 |
| 3 | TLVKLQEELSE | 0.9933139 | 48 | 58 |
| 4 | DPYTAMKFTYDLL | 1.0 | 85 | 97 |