Protein Sequence of the antigen tr|Q9J510|Q9J510_FOWPN ORF FPV225 vaccinia B20R homolog OS=Fowlpox virus (strain NVSL) OX=928301 GN=FPV225 PE=4 SV=1
MKYVNFINAYSVYDIYINKNKIDINIPLHINYDLKYKEIKNEFPIYRDMIEKKIRYILDKPNLVYKVINCMSEYMDSTYWMFLPTEIKFKVLSYLSSKDLYFII
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MKYVNFINAYSVYD | 0.9978294 | 1 | 14 |
| 2 | HINYDLKYKEI | 0.9725035 | 29 | 39 |
| 3 | LVYKVINCMSEYM | 1.0 | 63 | 75 |
| 4 | DSTYWMFLP | 0.999994 | 76 | 84 |
| 5 | TEIKFKVLSY | 1.0 | 85 | 94 |
| 6 | LSSKDLYFI | 1.0 | 95 | 103 |