Protein Sequence of the antigen tr|Q77NT1|Q77NT1_FOWPN ORF FPV087 HT motif gene family protein OS=Fowlpox virus (strain NVSL) OX=928301 GN=FPV087 PE=4 SV=1
MEFDISSCRMIYSVLEQYHFVTDNRYNNHNQKFRIILYCLKDSTIKKYPYRFVSEIHFVRYIINKFRGKNLYKISIEAIDISKGRQQIIRT
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | LEQYHFVTDNRYNN | 1.0 | 15 | 28 |
| 2 | HNQKFRIIL | 0.99976337 | 29 | 37 |
| 3 | FVSEIHFVRYIIN | 1.0 | 52 | 64 |
| 4 | KFRGKNLYK | 1.0 | 65 | 73 |