Protein Sequence of the antigen tr|Q775R0|Q775R0_CAMPS Core protein OPG142 OS=Camelpox virus (strain CMS) OX=203172 GN=CMP132L PE=3 SV=1
MFVDDNSLIIYSTWPSTLSDSSGRVIVMPDNRSFTFKEGFKLDESIKSILLVNPSSIDLLKIRVYKNRIKWMGNIFVLFEKENIPPPFRLVNDK
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MFVDDNSLIIYST | 0.9997142 | 1 | 13 |
| 2 | SIKSILLVNPS | 1.0 | 45 | 55 |
| 3 | SIDLLKIRVY | 1.0 | 56 | 65 |
| 4 | KNRIKWMGNIFV | 1.0 | 66 | 77 |
| 5 | LFEKENIPP | 0.9999967 | 78 | 86 |