Protein Sequence of the antigen tr|Q76QK0|Q76QK0_COWPX Entry-fusion complex protein OPG094 OS=Cowpox virus OX=10243 GN=N5R PE=3 SV=1
MENVPNVYFNPVFIEPTFKHSLLSVYKHRLIVLFEVFVVFILIYVFFRSELNMFFMPKRKIPDPIDRLRRANLACEDDKLMIYGLPWMTTQTSALSINSKPIVYKDCAKLLRSINGSQPVSLNDVLRR
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MENVPNVYFNPV | 0.8363032 | 1 | 12 |
| 2 | FIEPTFKHSLLSV | 0.7901205 | 13 | 25 |
| 3 | VFILIYVFFRSELN | 1.0 | 39 | 52 |
| 4 | IDRLRRANLACEDD | 0.99908274 | 65 | 78 |
| 5 | KLMIYGLPWMTTQ | 1.0 | 79 | 91 |
| 6 | PIVYKDCAKLLRS | 0.99998635 | 101 | 113 |