Protein Sequence of the antigen tr|Q6VZF3|Q6VZF3_CNPV CNPV194 virion protein OS=Canarypox virus OX=44088 GN=CNPV194 PE=4 SV=1
MDLGLRLIEIYTVFNKGITFQQDVDNILLSDYIIVIYSDNGKMCEIHSFDRVARFDTGNIYQQVKYVYKSKEDYLPILFPSNDILRSFNEEPSSKVERISYMSSKNTHPPHPKMILLELFNGFKTNKKINYYYYTRPTLS
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MDLGLRLIEIYTVF | 1.0 | 1 | 14 |
| 2 | NILLSDYIIVI | 1.0 | 26 | 36 |
| 3 | YQQVKYVYKS | 0.99994975 | 61 | 70 |
| 4 | KEDYLPILF | 1.0 | 71 | 79 |
| 5 | PSNDILRSFNE | 0.99999964 | 80 | 90 |
| 6 | KINYYYYTRPTL | 0.99998707 | 128 | 139 |