Protein Sequence of the antigen tr|Q6VZ26|Q6VZ26_CNPV CNPV321 EFc-like protein OS=Canarypox virus OX=44088 GN=CNPV321 PE=4 SV=1
MVMEFNVFPIGEELGKSVLASASNPLNSENDHTGDGSFIAKVIRNVGFCRPRYLLASAGDTVKIYFLEGKGGLIYSVSRVGSSNDEDNSEYLHEGHCVEFKTDHQCLITLACTSPSNTVVYWLE
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | IGEELGKSVLASA | 1.0 | 10 | 22 |
| 2 | SFIAKVIRNVGF | 1.0 | 37 | 48 |
| 3 | DTVKIYFLE | 0.9999967 | 60 | 68 |
| 4 | SRVGSSNDED | 1.0 | 78 | 87 |
| 5 | TLACTSPSNTV | 1.0 | 109 | 119 |