Protein Sequence of the antigen tr|Q6TVC5|Q6TVC5_9POXV Uncharacterized protein OS=Bovine papular stomatitis virus OX=129727 PE=4 SV=1
MDKSLAVAVRLVEGLSPLDVAVCLCHLRAEQPARRFPAIDEASGEAFLDFEFADGDVASRYLPMCARELAPDERKAHMSAIACRLTEADLALAAGPRGKARAVIRVCKNKKKVHRLLRLIKESEDRDVDFSFIRDAVLR
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MDKSLAVAVRLVEG | 0.9930266 | 1 | 14 |
| 2 | LSPLDVAVCLCHLR | 1.0 | 15 | 28 |
| 3 | DEASGEAFLDFE | 1.0 | 40 | 51 |
| 4 | ARELAPDERKAHMS | 0.94654965 | 66 | 79 |
| 5 | DLALAAGPRG | 1.0 | 89 | 98 |