Protein Sequence of the antigen tr|Q6TUZ1|Q6TUZ1_YMTV5 21L OS=Yaba monkey tumor virus (strain VR587) OX=928314 PE=4 SV=1
MNSTINFEDSEFGANMVMVISVFVLMISFLVFMLLYLIKWSYVMGFLNDVKIKIMNMTTRRSFAHLDDIYYTSDDVIGLNVE
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MNSTINFED | 1.0 | 1 | 9 |
| 2 | SEFGANMVMVISVF | 0.9999999 | 10 | 23 |
| 3 | VLMISFLVFMLLY | 1.0 | 24 | 36 |
| 4 | VKIKIMNMTTRR | 0.999999 | 50 | 61 |
| 5 | SFAHLDDIYY | 1.0 | 62 | 71 |