Protein Sequence of the antigen tr|Q6TUS5|Q6TUS5_YMTV5 93L OS=Yaba monkey tumor virus (strain VR587) OX=928314 PE=4 SV=1
MSWHLKYNVVLDEPKKCSKCFSNLFEYIVQDSETMKIMLEDQPKKLQTLKRFLSATRNKHFTYKILDEEIRRVLT
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MSWHLKYNVV | 1.0 | 1 | 10 |
| 2 | LDEPKKCSKCFS | 1.0 | 11 | 22 |
| 3 | NLFEYIVQDS | 1.0 | 23 | 32 |
| 4 | QTLKRFLSATRN | 0.9999625 | 47 | 58 |
| 5 | KHFTYKILDEEI | 1.0 | 59 | 70 |