Protein Sequence of the antigen tr|Q2F847|Q2F847_ORFV Viral interleukin-10 homolog OS=Orf virus OX=10258 PE=3 SV=1
MSKNKILVCFVIILTYTLYTDAYCVEYEESEEDKQQCGSSSNFPASLPHMLRELRAAFGKVKTFFQMKDQLNSMLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKLKTLRLRLRRCHRFLPCENKSKAVEQVKRVFNMLQERGVYKAMSEFDIFINYIESYMTTKM
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | EYEESEEDKQ | 1.0 | 26 | 35 |
| 2 | MIQFYLEEV | 1.0 | 96 | 104 |
| 3 | MPQAENHGPDIKEH | 0.99999017 | 105 | 118 |
| 4 | RLRLRRCHRFLPCE | 0.99999994 | 130 | 143 |
| 5 | RVFNMLQER | 1.0 | 154 | 162 |
| 6 | GVYKAMSEFDI | 1.0 | 163 | 173 |