Protein Sequence of the antigen tr|Q1M1R4|Q1M1R4_9POXV DNA-binding virion core protein OS=Vaccinia virus OX=10245 GN=F17R PE=3 SV=1
MNSHFASAHTPFYINTKEGRYLVLKAVKVCDVRTVECEGSKASCVLKVDKPSSPACERRPSSPSRCERMNNPGKQVPFMRTDMLQNMFAANRDNVASRLLS
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MNSHFASAHTPFY | 0.9999416 | 1 | 13 |
| 2 | INTKEGRYL | 1.0 | 14 | 22 |
| 3 | VLKAVKVCDVR | 0.9999989 | 23 | 33 |
| 4 | TVECEGSKASC | 1.0 | 34 | 44 |
| 5 | FMRTDMLQN | 1.0 | 78 | 86 |