Protein Sequence of the antigen tr|Q1HTR5|Q1HTR5_9POXV Conserved hypothetical pox protein OS=Squirrelpox virus OX=240426 GN=O6R PE=4 SV=1
MDVFNTLRFLESTGFSGAASMLPRAKVRLSHRGADFVFYRPKPSTVQRYMSACGVWHSDVVVLGKVVMCGEKLLLFYMDLCYHGASMNGSLYRLGTSIRSLSLRERRLMARSADPEDDSVCCWGLSEEDYYPGPRGRLSSASSSGSLERPEFELGSDEDSD
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MDVFNTLRFLES | 1.0 | 1 | 12 |
| 2 | DFVFYRPKPSTV | 0.9979797 | 35 | 46 |
| 3 | KLLLFYMDLC | 1.0 | 72 | 81 |
| 4 | YRLGTSIRSLSL | 0.996654 | 92 | 103 |
| 5 | ADPEDDSVCCW | 0.9998188 | 113 | 123 |
| 6 | GLSEEDYYPG | 1.0 | 124 | 133 |