Protein Sequence of the antigen tr|Q0NPF4|Q0NPF4_9POXV 11kDa DNA-binding phosphoprotein OS=Taterapox virus OX=28871 GN=TATV_DAH68_057 PE=3 SV=1
MNSHFASAHTPFYINTKEGRYLVLKAVKVCDVRTVECEGSKASCVLKVDKPSSPACERRPSSPSRCERMNNPGKQVPFMRTDMLQNMFAANRDNVASRLLS
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | FYINTKEGRY | 0.999999 | 12 | 21 |
| 2 | LVLKAVKVCD | 1.0 | 22 | 31 |
| 3 | VRTVECEGSK | 0.99719405 | 32 | 41 |
| 4 | CERMNNPGK | 1.0 | 66 | 74 |
| 5 | QVPFMRTDMLQNMF | 1.0 | 75 | 88 |