Protein Sequence of the antigen tr|Q0N5X8|Q0N5X8_VARV Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Variola virus OX=10255 GN=13-62_L15 PE=3 SV=1
MFNMNINSPVRFVKETNRAKSPTRQSPYAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKFCYGRIAPRSGLSLKGIDIGGGVIDEDYRGNIGVILINNGKYTFNVNTGDRIAQLIYQRIYYPELKEVQSLDSTDRGDQGFGSTGLR
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MFNMNINSPVRF | 0.9999683 | 1 | 12 |
| 2 | VKETNRAKSPT | 1.0 | 13 | 23 |
| 3 | DLYSAYDYTIPP | 0.55241543 | 33 | 44 |
| 4 | PKFCYGRIAP | 1.0 | 59 | 68 |
| 5 | RSGLSLKGIDIGG | 1.0 | 69 | 81 |
| 6 | TGDRIAQLIY | 0.99986625 | 108 | 117 |