Protein Sequence of the antigen tr|Q0GP67|Q0GP67_HSPV HSPV025 OS=Horsepox virus OX=397342 PE=4 SV=1

MNVYNKADSFFLESDSIKDIIHDYICWLSMTDEMRPSIGNVFKAMETFKIDAGRYYDGNIYELAKDINAMSFDGFIRSLQTIASKKDKLTVYGTMGLLSIVVDINKGRDVSNIKFAAVIIILMEYIFDDTDLSHLKVALYRRIQRRYPIDDDVDR

Download Epitopes

Epitope Number Epitope Epitope Prediction Score Epitope Start Epitope End
1 MNVYNKADSFFLES 0.99999595 1 14
2 DSIKDIIHD 0.79622483 15 23
3 RPSIGNVFKAMETF 0.9685571 35 48
4 IYELAKDINA 1.0 60 69
5 GLLSIVVDINK 1.0 96 106
6 GRDVSNIKFAAVII 0.99949265 107 120
7 ILMEYIFDDTDLS 1.0 121 133