Protein Sequence of the antigen tr|Q0GNZ2|Q0GNZ2_HSPV Entry-fusion complex protein OPG094 OS=Horsepox virus OX=397342 PE=3 SV=1
MENVPNVYFNPVFIEPTFKHSLLSVYKHRLIVLFEVFIVFILIYVFFRSELNMFFMPKRKIPDPIDRLRRANLACEDDKLMIYGLPWMTTQTSALSINSKPIVYKDCAKLLRSINGSQPVSLNDVLRR
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | PVFIEPTFKH | 0.99517834 | 11 | 20 |
| 2 | IVLFEVFIV | 0.9999983 | 31 | 39 |
| 3 | FILIYVFFRSELNM | 1.0 | 40 | 53 |
| 4 | KLMIYGLPWMTTQT | 1.0 | 79 | 92 |
| 5 | VYKDCAKLL | 1.0 | 103 | 111 |