Protein Sequence of the antigen tr|I0AZ99|I0AZ99_9POXV Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Ectromelia virus ERPV OX=1452750 GN=ERPV_028 PE=3 SV=1
MFNMNINSPVRFVKETNRAKSPTRQSNHAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKFCYGRIAPRSGLSLKGIDIGGGVIDEDYRGNIGVILINNGKCTFNVNTGDRIAQLIYQRIYYPELEEVQSLDSTDRGAQGFGSTGLR
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | KETNRAKSPTRQS | 1.0 | 14 | 26 |
| 2 | NHAAGYDLYS | 1.0 | 27 | 36 |
| 3 | AYDYTIPPG | 0.9998658 | 37 | 45 |
| 4 | SMPKFCYGRIAP | 1.0 | 57 | 68 |
| 5 | RSGLSLKGIDI | 1.0 | 69 | 79 |
| 6 | GGGVIDEDYRGN | 1.0 | 80 | 91 |
| 7 | QLIYQRIYYPE | 1.0 | 114 | 124 |