Protein Sequence of the antigen tr|A7XCQ8|A7XCQ8_9POXV C-type lectin-like protein domain OS=Tanapox virus OX=99000 GN=123R PE=4 SV=1

MKSFNRQTVNKIKRYSTPAAIFMILSTVVSGIGTVLKFKHELFPSACARGWIPYDNYCYLDTNLQLAANGALNVCNSYKARLPKTNFRHLKVLSLTYSKHFWVGLKKKDNRWLDISTNKTIDMNSNIDLTKTKGKYDNENSICFVYKMGELKGVICDIVNYIVCVKKFYK

Download Epitopes

Epitope Number Epitope Epitope Prediction Score Epitope Start Epitope End
1 MKSFNRQTVNK 0.9999975 1 11
2 FKHELFPSACAR 0.9359574 38 49
3 KDNRWLDISTNKTI 0.9999152 108 121
4 DMNSNIDLTKTKG 0.89330655 122 134
5 KYDNENSICFVYK 1.0 135 147
6 DIVNYIVCV 1.0 157 165