Protein Sequence of the antigen tr|A0A1C9HI36|A0A1C9HI36_LSDV Kelch-like protein OS=Lumpy skin disease virus OX=59509 GN=LW019a_1 PE=4 SV=1
MTLKRYINKEYVEELKYMLLKNDYDRILIFTIGGISQTRKDIFEISSNYFKKAIKKYSNEVKLPFKYKPFTYVLEYINTGYITLNSKNVVDIFSISNVIEIKFIMDACTDFMINYIDDSNCVDILEDLICMVVTMCTMLQINILKKGLCI
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MTLKRYINKEYVEE | 1.0 | 1 | 14 |
| 2 | DIFEISSNYFKKA | 1.0 | 41 | 53 |
| 3 | IKKYSNEVKL | 1.0 | 54 | 63 |
| 4 | PFKYKPFTYVLE | 0.99993294 | 64 | 75 |
| 5 | KNVVDIFSISN | 0.9987487 | 87 | 97 |