Protein Sequence of the antigen tr|A0A1C9HHI9|A0A1C9HHI9_LSDV LS136 OS=Lumpy skin disease virus OX=59509 GN=LSDV136 PE=4 SV=1
MDNNIVDVDEYRMCFIYDKVDYINIDDPIKNIIEEYFLWRGLVGRIGRKPSKIGKLFVDFINLDLTAKKMLGDLDLLFTDILKLDDINGANERLSNFVKFVNINFNNKPLVLLGLLGAVSEFWGKKKISVNGIMSVFLSNISNDTLLEICNHI
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MDNNIVDVDEYRMC | 0.99999994 | 1 | 14 |
| 2 | YFLWRGLVGRIG | 1.0 | 36 | 47 |
| 3 | RLSNFVKFVN | 1.0 | 93 | 102 |
| 4 | LLGAVSEFWGKK | 1.0 | 115 | 126 |
| 5 | SNISNDTLLEIC | 1.0 | 139 | 150 |