Protein Sequence of the antigen tr|A0A1C9HHD8|A0A1C9HHD8_LSDV DNA-directed RNA polymerase subunit OS=Lumpy skin disease virus OX=59509 GN=LD069 PE=3 SV=1
MNPHNVKYLAKILCLKTEILKNPYAIISKDVVLRYNTTIKYGDLVTYITVQHKIDATKTLFQVFNESSVTYSPLENDYGFPIIITSFLQTGHNKFPINFLYIDIVASDLFPKFVRLTDEEIVTVQSVLQIGDSKESLKLPKMLETEIAAKILFHKDIPLKIIRFFRNNIITGIEISDRAVITVLD
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MNPHNVKYLAKILC | 1.0 | 1 | 14 |
| 2 | KDVVLRYNTT | 0.801137 | 29 | 38 |
| 3 | IKYGDLVTYITV | 1.0 | 39 | 50 |
| 4 | TSFLQTGHNK | 1.0 | 85 | 94 |
| 5 | LFPKFVRLTDEE | 1.0 | 109 | 120 |
| 6 | RNNIITGIEIS | 1.0 | 166 | 176 |