Protein Sequence of the antigen tr|A0A0R5TZ77|A0A0R5TZ77_9POXV 25 kDa core protein OPG138 OS=Vaccinia virus OX=10245 GN=A12L PE=3 SV=1
MADKKNLAVRSSYDDYIETVNKITPQLKNLLAQIGGDAAVKGGNNNLNSQTDVTAGACDTKSKSSKCITCKPKSKSSSSSTSASKGSKNTSGAPRRRTTVTTTSYNAMDGQIVQAVTNAGKIVYGTVRDGQLEVRGMVGEINHDLLGIDSVNAGKKKPSKKMPTNKKINMSSGMRRQEQINPDDCCLDMGMY
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | KITPQLKNLLA | 1.0 | 22 | 32 |
| 2 | GGNNNLNSQTDVT | 0.9999653 | 42 | 54 |
| 3 | AGACDTKSK | 0.9999789 | 55 | 63 |
| 4 | SSSSSTSAS | 1.0 | 76 | 84 |
| 5 | KGSKNTSGAP | 1.0 | 85 | 94 |
| 6 | INHDLLGIDSVN | 1.0 | 141 | 152 |