Protein Sequence of the antigen tr|A0A0R5TYX7|A0A0R5TYX7_9POXV Putative monoglyceride lipase OS=Vaccinia virus OX=10245 GN=40 PE=4 SV=1

MTLVQHVVTIKSTYWVIPWELASYDNPNLFTAMILMSPLVNADAVSRLNLLAAKLMGTITPNAPVGKLCPESVSRDMDKVYKYQYDPLINHEKIKAGFASQVLKATNKVNTPPTLILQGTNNKISDVLGAYYFMQHANCNREIKIYEGAKHHLHKETDEVKKSVMKEIETWIFNRVK

Download Epitopes

Epitope Number Epitope Epitope Prediction Score Epitope Start Epitope End
1 MTLVQHVVTIKS 0.9885908 1 12
2 TYWVIPWELAS 0.94131887 13 23
3 YDNPNLFTAMILMS 0.9999998 24 37
4 GAYYFMQHANC 0.93849516 129 139
5 NREIKIYEGAKH 1.0 140 151