Protein Sequence of the antigen tr|A0A0R5TYX7|A0A0R5TYX7_9POXV Putative monoglyceride lipase OS=Vaccinia virus OX=10245 GN=40 PE=4 SV=1
MTLVQHVVTIKSTYWVIPWELASYDNPNLFTAMILMSPLVNADAVSRLNLLAAKLMGTITPNAPVGKLCPESVSRDMDKVYKYQYDPLINHEKIKAGFASQVLKATNKVNTPPTLILQGTNNKISDVLGAYYFMQHANCNREIKIYEGAKHHLHKETDEVKKSVMKEIETWIFNRVK
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MTLVQHVVTIKS | 0.9885908 | 1 | 12 |
| 2 | TYWVIPWELAS | 0.94131887 | 13 | 23 |
| 3 | YDNPNLFTAMILMS | 0.9999998 | 24 | 37 |
| 4 | GAYYFMQHANC | 0.93849516 | 129 | 139 |
| 5 | NREIKIYEGAKH | 1.0 | 140 | 151 |