Protein Sequence of the antigen tr|A0A0M3ZCU3|A0A0M3ZCU3_9POXV 25 kDa core protein OPG138 OS=Turkeypox virus OX=336486 PE=3 SV=1
MAGKRELQQQSSFSEYLDALHKIDPQLKTLLSHISSITGNTSQTNQLADTLTTKNSNLHNVTSTSDTCAGAPRVRSRCTTAIRKPCTPRRRNGMASNEQQIQAVTNTGKIVYGVVNEDGKLEVKGHVGEIKEDLLGLELDVVNAGRKTRTRKTSSRKKCMMQQNHQIMP
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | IDPQLKTLLSH | 1.0 | 23 | 33 |
| 2 | ISSITGNTSQT | 1.0 | 34 | 44 |
| 3 | NQLADTLTTKN | 1.0 | 45 | 55 |
| 4 | GAPRVRSRCTTAI | 1.0 | 70 | 82 |
| 5 | RKPCTPRRRNGMAS | 0.96091217 | 83 | 96 |
| 6 | VKGHVGEIKEDLL | 1.0 | 123 | 135 |