Protein Sequence of the antigen sp|Q9J5C0|RPO5_FOWPN DNA-directed RNA polymerase 30 kDa polypeptide OS=Fowlpox virus (strain NVSL) OX=928301 GN=RPO30 PE=3 SV=1
MDMMKIIKKYINSEEEAQKLLKWAIDNANIYYLRNIVNTKVNIEETKFKTVHNIGIEYSKDNKYKLSYRNKPSIATNEKYKELCNLIRSTNGIEKETLRYLLFGIKCVHAKVEYDIEKVPDYDYSNYFDVLKEKSTIRCVACKSNNTIPMILQTRSSDEEPTVRVVCKDCGKNFAPPRLKFN
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MDMMKIIKK | 1.0 | 1 | 9 |
| 2 | YINSEEEAQK | 1.0 | 10 | 19 |
| 3 | IEETKFKTVH | 0.9999922 | 43 | 52 |
| 4 | YKLSYRNKPSIA | 0.9999999 | 64 | 75 |
| 5 | RSTNGIEKETLRY | 1.0 | 88 | 100 |
| 6 | LLFGIKCVHAKV | 1.0 | 101 | 112 |
| 7 | TIPMILQTRSS | 1.0 | 147 | 157 |
| 8 | DEEPTVRVVC | 1.0 | 158 | 167 |