Protein Sequence of the antigen sp|Q9J5C0|RPO5_FOWPN DNA-directed RNA polymerase 30 kDa polypeptide OS=Fowlpox virus (strain NVSL) OX=928301 GN=RPO30 PE=3 SV=1

MDMMKIIKKYINSEEEAQKLLKWAIDNANIYYLRNIVNTKVNIEETKFKTVHNIGIEYSKDNKYKLSYRNKPSIATNEKYKELCNLIRSTNGIEKETLRYLLFGIKCVHAKVEYDIEKVPDYDYSNYFDVLKEKSTIRCVACKSNNTIPMILQTRSSDEEPTVRVVCKDCGKNFAPPRLKFN

Download Epitopes

Epitope Number Epitope Epitope Prediction Score Epitope Start Epitope End
1 MDMMKIIKK 1.0 1 9
2 YINSEEEAQK 1.0 10 19
3 IEETKFKTVH 0.9999922 43 52
4 YKLSYRNKPSIA 0.9999999 64 75
5 RSTNGIEKETLRY 1.0 88 100
6 LLFGIKCVHAKV 1.0 101 112
7 TIPMILQTRSS 1.0 147 157
8 DEEPTVRVVC 1.0 158 167