Protein Sequence of the antigen sp|Q9J554|A14_FOWPN Virion membrane protein A14 homolog OS=Fowlpox virus (strain NVSL) OX=928301 GN=FPV179 PE=3 SV=1
MDPLGFFRNRPSYVVVFGIILLIVACICAYIELSKSGKPADSALRSISIISFILAILLLLGIILFSGYNRYCTGNVVDESRYATSPGTEIQ
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MDPLGFFRNRP | 0.78534555 | 1 | 11 |
| 2 | SYVVVFGIILLI | 1.0 | 12 | 23 |
| 3 | VACICAYIELSK | 0.99962497 | 24 | 35 |
| 4 | SGKPADSALRSI | 1.0 | 36 | 47 |
| 5 | SIISFILAILLLLG | 1.0 | 48 | 61 |
| 6 | IILFSGYNR | 1.0 | 62 | 70 |