Protein Sequence of the antigen sp|Q775Z7|DUT_CAMPS Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Camelpox virus (strain CMS) OX=203172 GN=OPG046 PE=3 SV=1
MFNMNINSPVRFVKETNRAKSPTRQSPYAAGYDLYSAYYYTIPPGERQLIKTDISMSMPKFCYGRIAPRSGLSLKGIDIGGGVIDEDYRGNIGVILINNGKCTFNVNTGDRIAQLIYQRIYYPELKEVQSLDSTDRGDQGFGSTGLR
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MFNMNINSPVRF | 0.9999683 | 1 | 12 |
| 2 | VKETNRAKSPTRQS | 1.0 | 13 | 26 |
| 3 | PYAAGYDLYSAY | 1.0 | 27 | 38 |
| 4 | YYTIPPGERQLIKT | 0.99641156 | 39 | 52 |
| 5 | IAPRSGLSLKGIDI | 1.0 | 66 | 79 |
| 6 | GGGVIDEDYRG | 1.0 | 80 | 90 |
| 7 | AQLIYQRIYYP | 0.9132327 | 113 | 123 |