Protein Sequence of the antigen sp|M1LLA2|VLTF2_MONPV Viral late gene transcription factor 2 OS=Monkeypox virus OX=10244 GN=OPG126 PE=3 SV=1
MAKRVSLPDVVISAPKAVFKPAKEEALACILPKYYKSMADMSIKTNSVIDKCWFCNQDLVFRPISIETFKGGEVGYFCSKICRDSLASMVKSHVALREEPKISLLPLVFYEDKEKVINTINLLRDKDGVYGSCYFKENSQIIDISLRSLL
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | LPKYYKSMADMSIK | 1.0 | 31 | 44 |
| 2 | TNSVIDKCWFCNQ | 1.0 | 45 | 57 |
| 3 | DLVFRPISIETF | 1.0 | 58 | 69 |
| 4 | KICRDSLASMV | 0.5881216 | 80 | 90 |
| 5 | KSHVALREE | 1.0 | 91 | 99 |
| 6 | PKISLLPLV | 0.9997939 | 100 | 108 |
| 7 | FYEDKEKVIN | 0.99987197 | 109 | 118 |
| 8 | YGSCYFKENS | 0.99893486 | 130 | 139 |