Protein Sequence of the antigen sp|A0A7H0DN19|DUT_MONPV Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Monkeypox virus OX=10244 GN=OPG046 PE=3 SV=1
MIFFMFNMNINSPVRFVKETNRAKSPTRQSPGAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKFCYGRIAPRSGLSLKGIDIGGGVIDEDYRGSIGVILINNGKCTFNVNTGDRIAQLIYQRIYYPELEEVQSLDSTDRGDQGFGSTGLR
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MIFFMFNMNINS | 1.0 | 1 | 12 |
| 2 | PVRFVKETNRAKS | 0.9999995 | 13 | 25 |
| 3 | YDLYSAYDY | 1.0 | 36 | 44 |
| 4 | TIPPGERQL | 1.0 | 45 | 53 |
| 5 | IKTDISMSMPKFC | 0.9045894 | 54 | 66 |
| 6 | YGRIAPRSG | 1.0 | 67 | 75 |
| 7 | DEDYRGSIG | 0.9184076 | 89 | 97 |
| 8 | QRIYYPELE | 0.6196155 | 122 | 130 |