Protein Sequence of the antigen YP_227546.1 hypothetical protein DpV83gp171 [Deerpox virus W-848-83]
MLCIFYLSRLCNLIIYSLYSLSMYPMKKLISFMFGELNPFHDVLPDPHKKDDDAEIFPDDEKIYLPIMPPEPNPTPNIKPKLKEQAEKPPISESNNGAGVVEKAIKPEEDRFNGVFDFMKMPNPFKRYYEYCYPYPYKKAKTQPKKVEEKIEKSFLEKMVEMVE
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MLCIFYLSRLCNL | 1.0 | 1 | 13 |
| 2 | IIYSLYSLS | 1.0 | 14 | 22 |
| 3 | IMPPEPNPTPN | 1.0 | 67 | 77 |
| 4 | IKPKLKEQAE | 1.0 | 78 | 87 |
| 5 | KPPISESNNGAG | 0.9987203 | 88 | 99 |
| 6 | NGVFDFMKMPNPFK | 1.0 | 113 | 126 |