Protein Sequence of the antigen YP_010085381.1 uracil-DNA glycosylase DNA polymerase processivity factor [Eastern grey kangaroopox virus]
MAGLRELRVEEWPHVIRYHPDWEPVMGRLAGELAEVGSWLLRDEPSPRSEDIFRQLSVPLTDKRVCLVGIDPYPNGATGVPFQSPDFSKRTIRTIATNLSRRCGISLYGNYDFALVEGVLPWNYYLSCRRGETKSHALYWERLANAFLSHIARFVKVFYFMGKTDFANYASKLDVPVSVVLGYHPAARGGQFDSEETFEIVNALLALHGLPAVNWAQGFLAL
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | PHVIRYHPDW | 1.0 | 13 | 22 |
| 2 | EPVMGRLAGEL | 1.0 | 23 | 33 |
| 3 | AEVGSWLLRDEP | 0.99498254 | 34 | 45 |
| 4 | SPRSEDIFR | 1.0 | 46 | 54 |
| 5 | GISLYGNYDF | 1.0 | 104 | 113 |
| 6 | YFMGKTDFANYASK | 1.0 | 159 | 172 |