Protein Sequence of the antigen YP_010085310.1 hypothetical protein KM541_gp024 [Eastern grey kangaroopox virus]
MGKKDIEDLALSYRDKLSGAREKLEKESALIDEVLDVIHEEDFESLRVHKFVLRGLLPPGDYAMALSMTRVTEDEFEDLYDSLTVDPKPFHPRSNSNIDKDISRVYTAVMSQGYDSVDYYLPWIRKINVALSSARFPPSLTRLVDESLLYVIRGK
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | LSYRDKLSGARE | 0.99999803 | 11 | 22 |
| 2 | FESLRVHKFVLRG | 1.0 | 43 | 55 |
| 3 | LLPPGDYAMALSMT | 0.9999998 | 56 | 69 |
| 4 | RVTEDEFEDLYDS | 0.99999946 | 70 | 82 |
| 5 | LTVDPKPFHP | 0.9730096 | 83 | 92 |
| 6 | SRVYTAVMSQ | 1.0 | 103 | 112 |
| 7 | GYDSVDYYLP | 1.0 | 113 | 122 |
| 8 | FPPSLTRLVDES | 1.0 | 136 | 147 |