Protein Sequence of the antigen YP_009480614.1 Crescent membrane/immature virion protein [Sea otter poxvirus]
MDEKLSLLAATVFAGEFTITDMLALELFLHNSKVISRNVCIDDTRKVIIDFNMGSYNLSDYIGKHLTTLTIDDRRKYAADIAREITLINVIQTNPKEYIQQSPTLKNAIKVYRNNKRIKKIKQLMNKSKAKDIDYTFLKDSLFR
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | GEFTITDMLALEL | 0.99999994 | 15 | 27 |
| 2 | FLHNSKVISRNV | 1.0 | 28 | 39 |
| 3 | MGSYNLSDY | 1.0 | 53 | 61 |
| 4 | IGKHLTTLT | 1.0 | 62 | 70 |
| 5 | IAREITLINV | 0.98049605 | 81 | 90 |
| 6 | IQTNPKEYIQQSPT | 0.70426995 | 91 | 104 |
| 7 | LKNAIKVYR | 0.99288106 | 105 | 113 |