Protein Sequence of the antigen YP_009408330.1 hypothetical protein CKM52_gp148 [Murmansk poxvirus]
MSILNTIRFLEKTSFCTKKRLFKEKTYLNHKKWEFVFYEPKVSTIRRYLEIGGINHNDFVILGKATYNGVKMLFIYMNLAYYGVSKVGSIYKLGSTIDKLSLTKSYISPYSESLKSNYLYDYSSEDDDDDDLDDDLDNDDDFE
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MSILNTIRFLEK | 1.0 | 1 | 12 |
| 2 | KEKTYLNHKKWEF | 1.0 | 23 | 35 |
| 3 | VFYEPKVSTIR | 0.9999997 | 36 | 46 |
| 4 | RYLEIGGINHND | 0.6973914 | 47 | 58 |
| 5 | FVILGKATYN | 0.9997373 | 59 | 68 |
| 6 | NYLYDYSSED | 0.99999994 | 117 | 126 |