Protein Sequence of the antigen YP_009408215.1 hypothetical protein CKM52_gp033 [Murmansk poxvirus]

MSSTWVVNDILEVEIYYDCATSVSEFPMYGYDYDERYDDPNWVCEVYNDCYEELPKKDIVEKLIDVVSQLFRKDYRKHTVHKLRWLFFKYSAIYMFKYHTGKLAPEYYEDNKLPPECEEFIKNL

Download Epitopes

Epitope Number Epitope Epitope Prediction Score Epitope Start Epitope End
1 MSSTWVVNDILE 0.99956393 1 12
2 SVSEFPMYGY 0.77285165 22 31
3 VHKLRWLFF 1.0 80 88
4 KYSAIYMFKYH 0.7536534 89 99
5 TGKLAPEYYE 0.9999616 100 109
6 DNKLPPECEEF 1.0 110 120