Protein Sequence of the antigen YP_009408215.1 hypothetical protein CKM52_gp033 [Murmansk poxvirus]
MSSTWVVNDILEVEIYYDCATSVSEFPMYGYDYDERYDDPNWVCEVYNDCYEELPKKDIVEKLIDVVSQLFRKDYRKHTVHKLRWLFFKYSAIYMFKYHTGKLAPEYYEDNKLPPECEEFIKNL
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MSSTWVVNDILE | 0.99956393 | 1 | 12 |
| 2 | SVSEFPMYGY | 0.77285165 | 22 | 31 |
| 3 | VHKLRWLFF | 1.0 | 80 | 88 |
| 4 | KYSAIYMFKYH | 0.7536534 | 89 | 99 |
| 5 | TGKLAPEYYE | 0.9999616 | 100 | 109 |
| 6 | DNKLPPECEEF | 1.0 | 110 | 120 |