Protein Sequence of the antigen YP_009046388.1 hypothetical protein HM89_gp162 [Pigeonpox virus]
MSLSDKDVKTHGDYQPSNEQILQKIRWAMENEADSLNRRNIKEIVVDVMKNWDHPLNEDIDKVLNWKNDTLNDLEHLNTDDNIKEIIQCLIREFAFKKINSIMYSYAMVKLNSDNETLKDKIKDYFIETILKDKRNCKPKPLPGLETKILDSIIRF
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | DYQPSNEQILQKI | 1.0 | 13 | 25 |
| 2 | DKVLNWKND | 1.0 | 61 | 69 |
| 3 | TLNDLEHLNT | 0.9945097 | 70 | 79 |
| 4 | DDNIKEIIQCL | 1.0 | 80 | 90 |
| 5 | IREFAFKKINSI | 0.9993003 | 91 | 102 |
| 6 | MYSYAMVKL | 1.0 | 103 | 111 |
| 7 | NSDNETLKDKIK | 1.0 | 112 | 123 |
| 8 | DYFIETILKDKR | 1.0 | 124 | 135 |
| 9 | NCKPKPLPGLET | 1.0 | 136 | 147 |