Protein Sequence of the antigen YP_009046363.1 hypothetical protein HM89_gp135 [Pigeonpox virus]
MNRNINFSPVFIEPRFKHEFLLSPQRYFYILVFEVIIALIILNFFFKEEILYTFFPLAKPPKNSINGLLDRTMLKCEEDGSLMISRPSGIYSALSLDGSPIRIPDCGLLLSSINGASSSTSPYSVFNRR
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | IEPRFKHEFLLSP | 0.9999853 | 12 | 24 |
| 2 | QRYFYILVF | 1.0 | 25 | 33 |
| 3 | EVIIALIILNFF | 0.9999439 | 34 | 45 |
| 4 | FKEEILYTFFPLAK | 0.9999992 | 46 | 59 |
| 5 | PPKNSINGLLD | 0.9999997 | 60 | 70 |
| 6 | LDGSPIRIPDCGLL | 0.8503301 | 96 | 109 |