Protein Sequence of the antigen YP_009046118.1 tumor necrosis factor receptor-like protein [Penguinpox virus]
MGKNSLVLTIGVLMTLITLRSSFSASTYRVRSSGLTCSTCPPGTHKERDCSLNTETICKACGEGEYTAHNNSLPKCLACKSCFNATEIETKSCDPTSDTICACREGYSINNLGECN
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MGKNSLVLT | 0.92789894 | 1 | 9 |
| 2 | LRSSFSASTYRVRS | 0.999776 | 19 | 32 |
| 3 | SGLTCSTCPPG | 0.9999748 | 33 | 43 |
| 4 | TICKACGEG | 0.9946644 | 56 | 64 |
| 5 | EYTAHNNSLPK | 0.98797816 | 65 | 75 |
| 6 | CLACKSCFNATEI | 0.8879102 | 76 | 88 |
| 7 | ACREGYSINNL | 1.0 | 102 | 112 |