Protein Sequence of the antigen YP_009046118.1 tumor necrosis factor receptor-like protein [Penguinpox virus]

MGKNSLVLTIGVLMTLITLRSSFSASTYRVRSSGLTCSTCPPGTHKERDCSLNTETICKACGEGEYTAHNNSLPKCLACKSCFNATEIETKSCDPTSDTICACREGYSINNLGECN

Download Epitopes

Epitope Number Epitope Epitope Prediction Score Epitope Start Epitope End
1 MGKNSLVLT 0.92789894 1 9
2 LRSSFSASTYRVRS 0.999776 19 32
3 SGLTCSTCPPG 0.9999748 33 43
4 TICKACGEG 0.9946644 56 64
5 EYTAHNNSLPK 0.98797816 65 75
6 CLACKSCFNATEI 0.8879102 76 88
7 ACREGYSINNL 1.0 102 112