Protein Sequence of the antigen YP_009046064.1 hypothetical protein HM90_gp069 [Penguinpox virus]
MEKSCQCNSVQEYQEMSIYEVNDILKHDGISPCYFGECKEDILKCDVSEYNIYNIYEISGLYTKFLEGNYLNFIDTFKLDDDVLDHIMYHFIEYLSILKNTVLSRKAICKRILNKDMYKKNKIRKPRNEFTYSNRKY
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | VQEYQEMSIYEV | 1.0 | 10 | 21 |
| 2 | FGECKEDILK | 1.0 | 35 | 44 |
| 3 | GNYLNFIDT | 1.0 | 68 | 76 |
| 4 | FKLDDDVLDH | 1.0 | 77 | 86 |
| 5 | ILKNTVLSRKAICK | 0.9999984 | 97 | 110 |
| 6 | RILNKDMYKK | 1.0 | 111 | 120 |
| 7 | NKIRKPRNEF | 0.88397384 | 121 | 130 |