Protein Sequence of the antigen YP_008004363.1 N1R/p28-like protein [Choristoneura biennis entomopoxvirus]
MEYFLYMPDERNETTILDNHSIDLNLNLINNNMEENSINNIYKALYNYNKVIKYIVKDYKIDIYILDVNLAIDCKNKSHETETIIKNELNCVFYRYNPNNKDFCIYKTIGDIFNIIKTIENDKIIM
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MEYFLYMPDER | 1.0 | 1 | 11 |
| 2 | NETTILDNHS | 0.989388 | 12 | 21 |
| 3 | MEENSINNIYKAL | 0.9999995 | 33 | 45 |
| 4 | YNYNKVIKYI | 1.0 | 46 | 55 |
| 5 | VKDYKIDIYILDV | 1.0 | 56 | 68 |
| 6 | SHETETIIKNE | 1.0 | 78 | 88 |