Protein Sequence of the antigen YP_008004200.1 unknown similar to AMEV023 [Choristoneura biennis entomopoxvirus]
MRGITFKNIVDNTIKWFQSNDNLIDLSLLISIIINELCVEYSLQCKIIHKYFKQGNKYFHYFLVSDGHTIYDTTLVNEENIFDTIDYNNLSDEEKMYEDILLNEYLSYVKNGIVDTNIYYYFDEIIKIIER
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MRGITFKNIVDNTI | 0.99241024 | 1 | 14 |
| 2 | KWFQSNDNLI | 1.0 | 15 | 24 |
| 3 | DLSLLISIIIN | 0.9997793 | 25 | 35 |
| 4 | ELCVEYSLQCKIIH | 0.9878361 | 36 | 49 |
| 5 | LVSDGHTIYDT | 1.0 | 63 | 73 |
| 6 | TLVNEENIFDTIDY | 1.0 | 74 | 87 |
| 7 | NNLSDEEKMYE | 0.98655 | 88 | 98 |