Protein Sequence of the antigen UOX39180.1 putative virion structural protein [Finch poxvirus]
MDLGLRLIEIYTVFNKCITFQQDVDNILLSDYVIVIYLDNGKMCEIHSFDRVARFDTGNIYQQVKYAYKSKKDYLPILFPSNDILKSFNEEPSSKVERISYMSSKNIHPPQHPKMILLELFNGFKTNKKINYYYYTRPTLS
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MDLGLRLIE | 1.0 | 1 | 9 |
| 2 | IYTVFNKCITF | 1.0 | 10 | 20 |
| 3 | QQDVDNILLS | 0.99999917 | 21 | 30 |
| 4 | KSKKDYLPILF | 1.0 | 69 | 79 |
| 5 | PSNDILKSFNEE | 0.9991361 | 80 | 91 |
| 6 | KMILLELFN | 0.9352717 | 114 | 122 |