Protein Sequence of the antigen NP_065039.1 ALI motif gene family protein [Amsacta moorei entomopoxvirus]

MENIIDSFIDTNQLILPNNIDNINLNLNIIHNIEDDSINNIYKALYKYNKVLKYIVKNYKIDLYILDVKLAIECVNNNKILCIDYEKEKIIKNELKCTFYKYNPNDKNFCIFKTIGEIFDIINKK

Download Epitopes

Epitope Number Epitope Epitope Prediction Score Epitope Start Epitope End
1 INNIYKALYK 1.0 38 47
2 YNKVLKYIVKN 1.0 48 58
3 ECVNNNKILCID 1.0 73 84
4 ELKCTFYKYNPN 1.0 94 105
5 DKNFCIFKTIGE 1.0 106 117