Protein Sequence of the antigen NP_065029.1 hypothetical protein AMV247 [Amsacta moorei entomopoxvirus]
MRIEYINEDFSTTDLNYNIISFISSDFVLCKDKCLIYIKKKYNSIKELKKQKKKSGEVAYIYKNNKYIIYIIIADYIESKVNILNILRALDNLKIILEKLKITDIMTSRSHIEDVYETDKLYKYLREIMPEELNLYLLL
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | TDLNYNIISF | 0.9999937 | 13 | 22 |
| 2 | ISSDFVLCKDK | 1.0 | 23 | 33 |
| 3 | CLIYIKKKYNSI | 0.9994296 | 34 | 45 |
| 4 | YIIIADYIES | 0.9886306 | 70 | 79 |
| 5 | KVNILNILRALDN | 0.9999771 | 80 | 92 |
| 6 | LKIILEKLKI | 1.0 | 93 | 102 |
| 7 | VYETDKLYKYLRE | 1.0 | 115 | 127 |
| 8 | IMPEELNLYLLL | 0.9998714 | 128 | 139 |