Protein Sequence of the antigen NP_065029.1 hypothetical protein AMV247 [Amsacta moorei entomopoxvirus]

MRIEYINEDFSTTDLNYNIISFISSDFVLCKDKCLIYIKKKYNSIKELKKQKKKSGEVAYIYKNNKYIIYIIIADYIESKVNILNILRALDNLKIILEKLKITDIMTSRSHIEDVYETDKLYKYLREIMPEELNLYLLL

Download Epitopes

Epitope Number Epitope Epitope Prediction Score Epitope Start Epitope End
1 TDLNYNIISF 0.9999937 13 22
2 ISSDFVLCKDK 1.0 23 33
3 CLIYIKKKYNSI 0.9994296 34 45
4 YIIIADYIES 0.9886306 70 79
5 KVNILNILRALDN 0.9999771 80 92
6 LKIILEKLKI 1.0 93 102
7 VYETDKLYKYLRE 1.0 115 127
8 IMPEELNLYLLL 0.9998714 128 139