Protein Sequence of the antigen NP_064988.1 hypothetical protein AMV206 [Amsacta moorei entomopoxvirus]
MDKYILTNKLYDISNYYALYLYTDIKIIINKNKKFKFYDIKSLIGIEIEEWINDNNKLLSDNNINFIEISHDDPIIHGYYTDLKNINMILILFNITDYIDYISNKIFDAISDNFIKNKMQYIEIIETKNKYNDEVIKLEKYTKMLAYEKNYINQ
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | NYYALYLYT | 1.0 | 15 | 23 |
| 2 | DIKIIINKNKKF | 0.9977442 | 24 | 35 |
| 3 | KLLSDNNINFIEI | 0.9999533 | 57 | 69 |
| 4 | ILFNITDYIDYI | 1.0 | 91 | 102 |
| 5 | SNKIFDAISDNF | 0.99999344 | 103 | 114 |
| 6 | KYTKMLAYEKNYIN | 0.76641965 | 140 | 153 |