Protein Sequence of the antigen NP_064948.1 hypothetical protein AMV166 [Amsacta moorei entomopoxvirus]
MSDVDYDDDQLEPSDEEDMDDLVYSEVCANDESDESEINLLDEIINEEQEMEIIKKIKTKDKIKYFKGKIIDMNKINKAKEKYLYNIKFNELLSIFLNYTNILQSGGLPLLDEIKLKNNYNIELFSNSSTTPETAAMIMLIIMNIPMCVKKNNKIYNREVLNIDKLNIDYINCYYQNVKNMLRCVTYNSNNKFDFNKFKILFPLFIEYINRDEISNEELDEIKNVKRIITNYDYENL
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MSDVDYDDDQLEPS | 0.99996567 | 1 | 14 |
| 2 | DEEDMDDLVY | 0.999081 | 15 | 24 |
| 3 | QEMEIIKKI | 1.0 | 49 | 57 |
| 4 | KTKDKIKYFKG | 1.0 | 58 | 68 |
| 5 | YLYNIKFNEL | 1.0 | 83 | 92 |
| 6 | TPETAAMIM | 0.99999624 | 131 | 139 |
| 7 | VTYNSNNKFD | 1.0 | 185 | 194 |
| 8 | EYINRDEISN | 1.0 | 207 | 216 |
| 9 | EELDEIKNVK | 0.72250396 | 217 | 226 |